DB-EnginesExtremeDB for everyone with an RTOSEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. Google Cloud Bigtable vs. InterSystems IRIS

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. Google Cloud Bigtable vs. InterSystems IRIS

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenFatDB  Xaus Vergleich ausschliessenGoogle Cloud Bigtable  Xaus Vergleich ausschliessenInterSystems IRIS  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.Das Unternehmen FatDB/FatCloud hat im Februar 2014 seine Tätigkeit beendet. FatDB wurde eingestellt und erscheint deshalb nicht mehr im Ranking.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Ein .NET NoSQL DBMS, das in SQL Server integriert werden kann.Google's NoSQL Big Data database service. It's the same database that powers many core Google services, including Search, Analytics, Maps, and Gmail.A containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalability
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document Store
Key-Value Store
Key-Value Store
Wide Column Store
Document Store
Key-Value Store
Object oriented DBMS
Relational DBMS
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte3,26
Rang#92  Overall
#13  Key-Value Stores
#8  Wide Column Stores
Punkte4,05
Rang#83  Overall
#14  Document Stores
#10  Key-Value Stores
#1  Object oriented DBMS
#45  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comcloud.google.com/­bigtablewww.intersystems.com/­products/­intersystems-iris
Technische Dokumentationwiki.blazegraph.comcloud.google.com/­bigtable/­docsdocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.cls
EntwicklerAtos Convergence CreatorsBlazegraphFatCloudGoogleInterSystems
Erscheinungsjahr20162006201220152018
Aktuelle Version17032.1.5, Maerz 20192023.3, Juni 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarkommerziellkommerziellkommerziell
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinjanein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
ImplementierungsspracheJavaJavaC#
Server BetriebssystemeLinuxLinux
OS X
Windows
WindowsgehostetAIX
Linux
macOS
Ubuntu
Windows
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreischemafreidepending on used data model
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesjaneinja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjaneinja
Sekundärindizesjajajaneinja
SQL infoSupport of SQLneinSPARQL is used as query languagenein infoÃœber Integration mit SQL Serverneinja
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
.NET Client API
LINQ
RESTful HTTP API
RPC
Windows WCF Bindings
gRPC (using protocol buffers) API
HappyBase (Python library)
HBase compatible API (Java)
JDBC
ODBC
RESTful HTTP API
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C#C#
C++
Go
Java
JavaScript (Node.js)
Python
.Net
C++
Java
JavaScript (Node.js)
Python
Server-seitige Scripts infoStored Proceduresneinjaja infoÃœber Applikationenneinja
Triggersjaneinja infoÃœber Applikationenneinja
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardingShardingSharding
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjajafrei wählbarer ReplikationsfaktorInternal replication in Colossus, and regional replication between two clusters in different zonesSource-Replica Replikation
MapReduce infoBietet ein API für Map/Reduce Operationenneinjajanein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual Consistency
Immediate Consistency
Immediate consistency (for a single cluster), Eventual consistency (for two or more replicated clusters)Immediate Consistency
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinneinja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDneinAtomic single-row operationsACID
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajajaja
Durability infoDauerhafte Speicherung der Datenjajajajaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjaneinja
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)nein infoSecurity Layer kann über Applikationen implementiert werdenAccess rights for users, groups and roles based on Google Cloud Identity and Access Management (IAM)yes
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphFatDBGoogle Cloud BigtableInterSystems IRIS
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphFatDBGoogle Cloud BigtableInterSystems IRIS
Erwähnungen in aktuellen Nachrichten

Infographic: What makes a Mobile Operator's setup future proof?
10. Februar 2024, Atos

bereitgestellt von Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Google's AI-First Strategy Brings Vector Support To Cloud Databases
1. März 2024, Forbes

Google Introduces Autoscaling for Cloud Bigtable for Optimizing Costs
31. Januar 2022, InfoQ.com

Google scales up Cloud Bigtable NoSQL database
27. Januar 2022, TechTarget

Google introduces Cloud Bigtable managed NoSQL database to process data at scale
6. Mai 2015, VentureBeat

Google Launches Cloud Bigtable, A Highly Scalable And Performant NoSQL Database
6. Mai 2015, TechCrunch

bereitgestellt von Google News

Consultmed moving its e-referral software to InterSystems's IRIS for Health and more briefs
6. Mai 2024, Mobihealth News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26. März 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26. März 2024, Datanami

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11. Januar 2024, Yahoo Finance

InterSystems and IPA's Subsidiary BioStrand Collaborate to Unveil the Innovative Integration of Vector Search with ...
28. März 2024, Business Wire

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

SingleStore logo

Build AI apps with Vectors on SQL and JSON with milliseconds response times.
Try it today.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Präsentieren Sie hier Ihr Produkt