DB-EnginesExtremeDB: mitigate connectivity issues in a DBMSEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS

Bitte wählen Sie ein weiteres System aus, um es in den Vergleich aufzunehmen.

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenFatDB  Xaus Vergleich ausschliessenInterSystems IRIS  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.Das Unternehmen FatDB/FatCloud hat im Februar 2014 seine Tätigkeit beendet. FatDB wurde eingestellt und erscheint deshalb nicht mehr im Ranking.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Ein .NET NoSQL DBMS, das in SQL Server integriert werden kann.A containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalability
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document Store
Key-Value Store
Document Store
Key-Value Store
Object oriented DBMS
Relational DBMS
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,77
Rang#222  Overall
#20  Graph DBMS
#8  RDF Stores
Punkte4,39
Rang#81  Overall
#13  Document Stores
#10  Key-Value Stores
#1  Object oriented DBMS
#44  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.intersystems.com/­products/­intersystems-iris
Technische Dokumentationwiki.blazegraph.comdocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.cls
EntwicklerAtos Convergence CreatorsBlazegraphFatCloudInterSystems
Erscheinungsjahr2016200620122018
Aktuelle Version17032.1.5, Maerz 20192023.3, Juni 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarkommerziellkommerziell
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinnein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
ImplementierungsspracheJavaJavaC#
Server BetriebssystemeLinuxLinux
OS X
Windows
WindowsAIX
Linux
macOS
Ubuntu
Windows
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreidepending on used data model
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesjaja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjaja
Sekundärindizesjajajaja
SQL infoSupport of SQLneinSPARQL is used as query languagenein infoÃœber Integration mit SQL Serverja
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
.NET Client API
LINQ
RESTful HTTP API
RPC
Windows WCF Bindings
JDBC
ODBC
RESTful HTTP API
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C#.Net
C++
Java
JavaScript (Node.js)
Python
Server-seitige Scripts infoStored Proceduresneinjaja infoÃœber Applikationenja
Triggersjaneinja infoÃœber Applikationenja
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardingSharding
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjajafrei wählbarer ReplikationsfaktorSource-Replica Replikation
MapReduce infoBietet ein API für Map/Reduce Operationenneinjanein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual Consistency
Immediate Consistency
Immediate Consistency
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDneinACID
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajaja
Durability infoDauerhafte Speicherung der Datenjajajaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjaja
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)nein infoSecurity Layer kann über Applikationen implementiert werdenyes
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRIS
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRIS
Erwähnungen in aktuellen Nachrichten

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

InterSystems expands InterSystems IRIS data platform with vector search to support next-generation AI applications
16. April 2024, ITWeb

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26. März 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26. März 2024, Datanami

ImmunoPrecise Antibodies And InterSystems Partner To Leverage AI In Life Sciences, Transforming Patient Care With ...
12. April 2024, StreetInsider.com

EXCLUSIVE: Immunoprecise Antibodies and InterSystems Integrate Vector Search With LENSai For AI-Driven ...
28. März 2024, Yahoo Finance

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

AllegroGraph logo

Graph Database Leader for AI Knowledge Graph Applications - The Most Secure Graph Database Available.
Free Download

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Ontotext logo

GraphDB allows you to link diverse data, index it for semantic search and enrich it via text analysis to build big knowledge graphs. Get it free.

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Präsentieren Sie hier Ihr Produkt