DB-EnginesExtremeDB for everyone with an RTOSEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS vs. Snowflake

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS vs. Snowflake

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenFatDB  Xaus Vergleich ausschliessenInterSystems IRIS  Xaus Vergleich ausschliessenSnowflake  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.Das Unternehmen FatDB/FatCloud hat im Februar 2014 seine Tätigkeit beendet. FatDB wurde eingestellt und erscheint deshalb nicht mehr im Ranking.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Ein .NET NoSQL DBMS, das in SQL Server integriert werden kann.A containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalabilityData warehousing service aus der Cloud für strukturierte und semi-strukturierte Daten
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document Store
Key-Value Store
Document Store
Key-Value Store
Object oriented DBMS
Relational DBMS
Relational DBMS
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte4,05
Rang#83  Overall
#14  Document Stores
#10  Key-Value Stores
#1  Object oriented DBMS
#45  Relational DBMS
Punkte121,33
Rang#9  Overall
#6  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.intersystems.com/­products/­intersystems-iriswww.snowflake.com
Technische Dokumentationwiki.blazegraph.comdocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.clsdocs.snowflake.net/­manuals/­index.html
EntwicklerAtos Convergence CreatorsBlazegraphFatCloudInterSystemsSnowflake Computing Inc.
Erscheinungsjahr20162006201220182014
Aktuelle Version17032.1.5, Maerz 20192023.3, Juni 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarkommerziellkommerziellkommerziell
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinneinja
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
ImplementierungsspracheJavaJavaC#
Server BetriebssystemeLinuxLinux
OS X
Windows
WindowsAIX
Linux
macOS
Ubuntu
Windows
gehostet
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreidepending on used data modelja infosupport of semi-structured data formats (JSON, XML, Avro)
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesjajaja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjajaja
Sekundärindizesjajajaja
SQL infoSupport of SQLneinSPARQL is used as query languagenein infoÃœber Integration mit SQL Serverjaja
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
.NET Client API
LINQ
RESTful HTTP API
RPC
Windows WCF Bindings
JDBC
ODBC
RESTful HTTP API
CLI Client
JDBC
ODBC
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C#.Net
C++
Java
JavaScript (Node.js)
Python
JavaScript (Node.js)
Python
Server-seitige Scripts infoStored Proceduresneinjaja infoÃœber Applikationenjauser defined functions
Triggersjaneinja infoÃœber Applikationenjanein infosimilar concept for controling cloud resources
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardingShardingja
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjajafrei wählbarer ReplikationsfaktorSource-Replica Replikationja
MapReduce infoBietet ein API für Map/Reduce Operationenneinjaneinnein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual Consistency
Immediate Consistency
Immediate ConsistencyImmediate Consistency
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinjaja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDneinACIDACID
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajajaja
Durability infoDauerhafte Speicherung der Datenjajajajaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjajanein
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)nein infoSecurity Layer kann über Applikationen implementiert werdenyesBenutzer mit feingranularem Berechtigungskonzept und Benutzerrollen
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRISSnowflake
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen
DrittanbieterCData: Connect to Big Data & NoSQL through standard Drivers.
» mehr

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRISSnowflake
DB-Engines Blog Posts

Snowflake is the DBMS of the Year 2022, defending the title from last year
3. Januar 2023, Matthias Gelbmann, Paul Andlinger

Snowflake is the DBMS of the Year 2021
3. Januar 2022, Paul Andlinger, Matthias Gelbmann

alle anzeigen

Erwähnungen in aktuellen Nachrichten

Infographic: What makes a Mobile Operator's setup future proof?
10. Februar 2024, Atos

bereitgestellt von Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Consultmed moving its e-referral software to InterSystems's IRIS for Health and more briefs
6. Mai 2024, Mobihealth News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26. März 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26. März 2024, Datanami

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11. Januar 2024, Yahoo Finance

InterSystems and IPA's Subsidiary BioStrand Collaborate to Unveil the Innovative Integration of Vector Search with ...
28. März 2024, Business Wire

bereitgestellt von Google News

Data's New Sheriff: Snowflake's Quest to Bring Order to the AI Frontier
20. Mai 2024, CDOTrends

Snowflake Ventures invests in Metaplane to ensure trust in data across the Data Cloud
15. Mai 2024, PR Newswire

Snowflake invests in Metaplane to solve data quality issues plaguing AI development
16. Mai 2024, VentureBeat

Briefing: Snowflake Said to Discuss Buying AI Startup Reka AI for $1 Billion
17. Mai 2024, The Information

Persistent & Snowflake Partner Up: Are You Ready for Next-Level Data Analytics?
20. Mai 2024, DATAQUEST

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

SingleStore logo

Build AI apps with Vectors on SQL and JSON with milliseconds response times.
Try it today.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Präsentieren Sie hier Ihr Produkt