DB-EnginesExtremeDB for everyone with an RTOSEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS vs. PostgreSQL

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS vs. PostgreSQL

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenFatDB  Xaus Vergleich ausschliessenInterSystems IRIS  Xaus Vergleich ausschliessenPostgreSQL  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.Das Unternehmen FatDB/FatCloud hat im Februar 2014 seine Tätigkeit beendet. FatDB wurde eingestellt und erscheint deshalb nicht mehr im Ranking.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Ein .NET NoSQL DBMS, das in SQL Server integriert werden kann.A containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalabilityWeit verbreitetes, allgemein einsetzbares Open Source RDBMS infoEntwickelt als objektorientiertes DBMS, im Laufe der Zeit um 'Standards' wie SQL erweitert
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document Store
Key-Value Store
Document Store
Key-Value Store
Object oriented DBMS
Relational DBMS
Relational DBMS infomit objektorientierten Erweiterungen, z.B.: benutzerdefinierte Datentypen/Funktionen und Vererbung. Key/Value handling mit hstore Modul.
Sekundäre DatenbankmodelleDocument Store
Graph DBMS infowith Apache Age
Spatial DBMS
Vektor DBMS infowith pgvector extension
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte4,05
Rang#83  Overall
#14  Document Stores
#10  Key-Value Stores
#1  Object oriented DBMS
#45  Relational DBMS
Punkte645,54
Rang#4  Overall
#4  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.intersystems.com/­products/­intersystems-iriswww.postgresql.org
Technische Dokumentationwiki.blazegraph.comdocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.clswww.postgresql.org/­docs
EntwicklerAtos Convergence CreatorsBlazegraphFatCloudInterSystemsPostgreSQL Global Development Group infowww.postgresql.org/­developer
Erscheinungsjahr20162006201220181989 info1989: Postgres, 1996: PostgreSQL
Aktuelle Version17032.1.5, Maerz 20192023.3, Juni 202316.3, Mai 2024
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarkommerziellkommerziellOpen Source infoBSD
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinneinnein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
  • PostgreSQL Flex @ STACKIT offers managed PostgreSQL Instances with adjustable CPU, RAM, storage amount and speed and several extensions available, in enterprise grade to perfectly match all application requirements. All 100% GDPR-compliant.
  • Aiven for PostgreSQL: Fully managed PostgreSQL for developers with 70+ extensions and flexible orchestration tools.
ImplementierungsspracheJavaJavaC#C
Server BetriebssystemeLinuxLinux
OS X
Windows
WindowsAIX
Linux
macOS
Ubuntu
Windows
FreeBSD
HP-UX
Linux
NetBSD
OpenBSD
OS X
Solaris
Unix
Windows
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreidepending on used data modelja
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesjajaja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjajaja infospecific XML-type available, but no XML query functionality.
Sekundärindizesjajajajaja
SQL infoSupport of SQLneinSPARQL is used as query languagenein infoÃœber Integration mit SQL Serverjaja infoStandard mit zahlreichen Erweiterungen
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
.NET Client API
LINQ
RESTful HTTP API
RPC
Windows WCF Bindings
JDBC
ODBC
RESTful HTTP API
ADO.NET
JDBC
native C library
ODBC
streaming API for large objects
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C#.Net
C++
Java
JavaScript (Node.js)
Python
.Net
C
C++
Delphi
Java infoJDBC
JavaScript (Node.js)
Perl
PHP
Python
Tcl
Server-seitige Scripts infoStored Proceduresneinjaja infoÃœber Applikationenjabenutzerdefinierte Funktionen inforealisiert z.B. mit spezifischer Sprache PL/pgSQL, aber auch andere Sprachen möglich (Perl, Python, Tcl, etc.)
Triggersjaneinja infoÃœber Applikationenjaja
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardingShardingpartitioning by range, list and (since PostgreSQL 11) by hash
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjajafrei wählbarer ReplikationsfaktorSource-Replica ReplikationSource-Replica Replikation infoandere Varianten durch Verwendung von 3rd party - tools
MapReduce infoBietet ein API für Map/Reduce Operationenneinjaneinnein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual Consistency
Immediate Consistency
Immediate ConsistencyImmediate Consistency
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinjaja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDneinACIDACID
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajajaja
Durability infoDauerhafte Speicherung der Datenjajajajaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjajanein
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)nein infoSecurity Layer kann über Applikationen implementiert werdenyesBenutzer mit feingranularem Berechtigungskonzept entsprechend SQL-Standard
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRISPostgreSQL
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen
DrittanbieterSharePlex is the reliable and affordable data replication solution for PostgreSQL migrations, high availability and more.
» mehr

pgDash: In-Depth PostgreSQL Monitoring.
» mehr

Navicat Monitor is a safe, simple and agentless remote server monitoring tool for PostgreSQL and many other database management systems.
» mehr

Fujitsu Enterprise Postgres: An Enterprise Grade PostgreSQL with the flexibility of a hybrid cloud solution combined with industry leading security, availability and performance.
» mehr

Instaclustr: Fully Hosted & Managed PostgreSQL
» mehr

CYBERTEC is your professional partner in PostgreSQL topics for over 20 years. As our main aim is to be your single-source all-in-one IT service provider, we offer a wide range of products and services. Visit our website for more details.
» mehr

Timescale: Calling all PostgreSQL users – the 2023 State of PostgreSQL survey is now open! Share your favorite extensions, preferred frameworks, community experiences, and more. Take the survey today!
» mehr

Navicat for PostgreSQL is an easy-to-use graphical tool for PostgreSQL database development.
» mehr

Redgate webinars: A series of key topics for new PostgreSQL users.
» mehr

Aiven for PostgreSQL: Fully managed PostgreSQL for developers with 70+ extensions and flexible orchestration tools.
» mehr

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRISPostgreSQL
DB-Engines Blog Posts

PostgreSQL is the DBMS of the Year 2023
2. Januar 2024, Matthias Gelbmann, Paul Andlinger

Snowflake is the DBMS of the Year 2022, defending the title from last year
3. Januar 2023, Matthias Gelbmann, Paul Andlinger

Snowflake is the DBMS of the Year 2021
3. Januar 2022, Paul Andlinger, Matthias Gelbmann

alle anzeigen

Konferenzen, Veranstaltungen und Webinare

Monitoring PostgreSQL with Redgate Monitor
Webinar, 10-11am CT / 4-5pm BST, 22. Mai 2024

Erwähnungen in aktuellen Nachrichten

Infographic: What makes a Mobile Operator's setup future proof?
10. Februar 2024, Atos

bereitgestellt von Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Consultmed moving its e-referral software to InterSystems's IRIS for Health and more briefs
6. Mai 2024, Mobihealth News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26. März 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26. März 2024, Datanami

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11. Januar 2024, Yahoo Finance

InterSystems and IPA's Subsidiary BioStrand Collaborate to Unveil the Innovative Integration of Vector Search with ...
28. März 2024, Business Wire

bereitgestellt von Google News

Let PostgreSQL Pick An Index For You
20. Mai 2024, iProgrammer

Continuously replicate Amazon DynamoDB changes to Amazon Aurora PostgreSQL using AWS Lambda | Amazon ...
14. Mai 2024, AWS Blog

Introducing OCI Database with PostgreSQL: Completing Our Cloud Database Suite for Every Need
14. November 2023, blogs.oracle.com

ServiceNow trades MariaDB for RaptorDB (PostgreSQL)
13. Mai 2024, Techzine Europe

General availability: Microsoft Entra ID integration with Azure Cosmos DB for PostgreSQL | Azure updates
13. März 2024, azure.microsoft.com

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

AllegroGraph logo

Graph Database Leader for AI Knowledge Graph Applications - The Most Secure Graph Database Available.
Free Download

Präsentieren Sie hier Ihr Produkt