DB-EnginesExtremeDB: mitigate connectivity issues in a DBMSEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS vs. NCache

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS vs. NCache

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenFatDB  Xaus Vergleich ausschliessenInterSystems IRIS  Xaus Vergleich ausschliessenNCache  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.Das Unternehmen FatDB/FatCloud hat im Februar 2014 seine Tätigkeit beendet. FatDB wurde eingestellt und erscheint deshalb nicht mehr im Ranking.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Ein .NET NoSQL DBMS, das in SQL Server integriert werden kann.A containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalabilityOpen-Source and Enterprise in-memory Key-Value Store
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document Store
Key-Value Store
Document Store
Key-Value Store
Object oriented DBMS
Relational DBMS
Key-Value Store
Sekundäre DatenbankmodelleDocument Store
Suchmaschine infoUsing distributed Lucene
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte4,05
Rang#83  Overall
#14  Document Stores
#10  Key-Value Stores
#1  Object oriented DBMS
#45  Relational DBMS
Punkte0,94
Rang#195  Overall
#29  Key-Value Stores
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.intersystems.com/­products/­intersystems-iriswww.alachisoft.com/­ncache
Technische Dokumentationwiki.blazegraph.comdocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.clswww.alachisoft.com/­resources/­docs
EntwicklerAtos Convergence CreatorsBlazegraphFatCloudInterSystemsAlachisoft
Erscheinungsjahr20162006201220182005
Aktuelle Version17032.1.5, Maerz 20192023.3, Juni 20235.3.3, April 2024
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarkommerziellkommerziellOpen Source infoEnterprise Edition available
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinneinnein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
ImplementierungsspracheJavaJavaC#C#, .NET, .NET Core, Java
Server BetriebssystemeLinuxLinux
OS X
Windows
WindowsAIX
Linux
macOS
Ubuntu
Windows
Linux
Windows
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreidepending on used data modelschemafrei
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesjajateilweise infoSupported data types are Lists, Queues, Hashsets, Dictionary and Counter
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjajanein
Sekundärindizesjajajajaja
SQL infoSupport of SQLneinSPARQL is used as query languagenein infoÃœber Integration mit SQL ServerjaSQL-like query syntax and LINQ for searching the cache. Cache Synchronization with SQL Server using SQL dependency.
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
.NET Client API
LINQ
RESTful HTTP API
RPC
Windows WCF Bindings
JDBC
ODBC
RESTful HTTP API
IDistributedCache
JCache
LINQ
Proprietäres native API
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C#.Net
C++
Java
JavaScript (Node.js)
Python
.Net
.Net Core
C#
Java
JavaScript (Node.js)
Python
Scala
Server-seitige Scripts infoStored Proceduresneinjaja infoÃœber Applikationenjanein infoUnterstützung für stored procedures mit SQL-Server CLR
Triggersjaneinja infoÃœber Applikationenjaja infoNotifications
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardingShardingja
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjajafrei wählbarer ReplikationsfaktorSource-Replica Replikationja, mit wählbarer Konsistenz
MapReduce infoBietet ein API für Map/Reduce Operationenneinjaneinja
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual Consistency
Immediate Consistency
Immediate ConsistencyEventual Consistency
Immediate Consistency
Strong Eventual Consistency over WAN with Conflict Resolution using Bridge Topology
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinjanein
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDneinACIDoptimistic Locking und pessimistic Locking
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajajaja
Durability infoDauerhafte Speicherung der Datenjajajajaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjajaja
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)nein infoSecurity Layer kann über Applikationen implementiert werdenyesAuthentifizierung für Zugriff auf Cache mittels Active Directory/LDAP (Rollen: user, administrator)
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRISNCache
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» mehr
NCache has been the market leader in .NET Distributed Caching since 2005 . NCache...
» mehr
Competitive advantagesNCache is 100% .NET/ .NET Core based which fully supports ASP.NET Core Sessions ,...
» mehr
Typical application scenariosNCache enables industries like retail, finance, banking IoT, travel, ecommerce, healthcare...
» mehr
Key customersBank of America, Citi, Natures Way, Charter Spectrum, Barclays, Henry Schein, GBM,...
» mehr
Market metricsMarket Leader in .NET Distributed Caching since 2005.
» mehr
Licensing and pricing modelsNCache Open Source is free on an as-is basis without any support. NCache Enterprise...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphFatDBInterSystems IRISNCache
Erwähnungen in aktuellen Nachrichten

Infographic: What makes a Mobile Operator's setup future proof?
10. Februar 2024, Atos

bereitgestellt von Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Consultmed moving its e-referral software to InterSystems's IRIS for Health and more briefs
6. Mai 2024, Mobihealth News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26. März 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26. März 2024, Datanami

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11. Januar 2024, Yahoo Finance

InterSystems and IPA's Subsidiary BioStrand Collaborate to Unveil the Innovative Integration of Vector Search with ...
28. März 2024, Business Wire

bereitgestellt von Google News

How to use NCache in ASP.Net Core
26. Februar 2019, InfoWorld

Custom Response Caching Using NCache in ASP.NET Core
22. April 2020, InfoQ.com

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

AllegroGraph logo

Graph Database Leader for AI Knowledge Graph Applications - The Most Secure Graph Database Available.
Free Download

Präsentieren Sie hier Ihr Produkt