DB-EnginesExtremeDB for everyone with an RTOSEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. BigchainDB vs. Blazegraph vs. YugabyteDB

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. BigchainDB vs. Blazegraph vs. YugabyteDB

Bitte wählen Sie ein weiteres System aus, um es in den Vergleich aufzunehmen.

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBigchainDB  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenYugabyteDB  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksBigchainDB is scalable blockchain database offering decentralization, immutability and native assetsHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.High-performance distributed SQL database for global, internet-scale applications. Wire and feature compatible with PostgreSQL.
Primäres DatenbankmodellDocument Store
Key-Value Store
Document StoreGraph DBMS
RDF Store
Relational DBMS
Sekundäre DatenbankmodelleDocument Store
Wide Column Store
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,79
Rang#212  Overall
#36  Document Stores
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte2,91
Rang#102  Overall
#51  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositorywww.bigchaindb.comblazegraph.comwww.yugabyte.com
Technische Dokumentationbigchaindb.readthedocs.io/­en/­latestwiki.blazegraph.comdocs.yugabyte.com
github.com/­yugabyte/­yugabyte-db
EntwicklerAtos Convergence CreatorsBlazegraphYugabyte Inc.
Erscheinungsjahr2016201620062017
Aktuelle Version17032.1.5, Maerz 20192.1, September 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoAGPL v3Open Source infoerweiterte kommerzielle Lizenz verfügbarOpen Source infoApache 2.0
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinnein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
YugabyteDB Managed is the fully managed database-as-a-service offering of YugabyteDB. Get started quickly, and effortlessly ensure continuous availability and limitless scale of your cloud native applications.
ImplementierungsspracheJavaPythonJavaC und C++
Server BetriebssystemeLinuxLinuxLinux
OS X
Windows
Linux
OS X
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreidepending on used data model
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalneinja infoRDF literal typesja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjaneinnein
Sekundärindizesjajaja
SQL infoSupport of SQLneinneinSPARQL is used as query languageyes, PostgreSQL compatible
APIs und andere ZugriffskonzepteLDAPCLI Client
RESTful HTTP API
Java API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
JDBC
YCQL, an SQL-based flexible-schema API with its roots in Cassandra Query Language
YSQL - a fully relational SQL API that is wire compatible with the SQL language in PostgreSQL
Unterstützte ProgrammiersprachenAll languages with LDAP bindingsGo
Haskell
Java
JavaScript
Python
Ruby
.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C
C#
C++
Go
Java
JavaScript (Node.js)
PHP
Python
Ruby
Rust
Scala
Server-seitige Scripts infoStored Proceduresneinjaja infosql, plpgsql, C
Triggersjaneinja
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardingHash and Range Sharding, row-level geo-partitioning
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjafrei wählbarer ReplikationsfaktorjaBased on Raft distributed consensus protocol, minimum 3 replicas for continuous availability
MapReduce infoBietet ein API für Map/Reduce Operationenneinneinnein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationStrong consistency on writes and tunable consistency on reads
Fremdschlüssel inforeferenzielle Integritätneinneinja infoRelationships in Graphsja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDDistributed ACID with Serializable & Snapshot Isolation. Inspired by Google Spanner architecture.
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajaja
Durability infoDauerhafte Speicherung der Datenjayes,with MongoDB ord RethinkDBjaja infobased on RocksDB
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjanein
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationyesSecurity and Authentication via Web Application Container (Tomcat, Jetty)ja
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBigchainDBBlazegraphYugabyteDB
Specific characteristicsYugabyteDB is an open source distributed SQL database for cloud native transactional...
» mehr
Competitive advantagesPostgreSQL compatible: Get instantly productive with a PostgreSQL compatible RDBMS....
» mehr
Typical application scenariosSystems of record and engagement for cloud native applications that require resilience,...
» mehr
Market metrics2 Million+ lifetime clusters deployed, 6.5K+ GitHub stars, 7K YugabyteDB Community...
» mehr
Licensing and pricing modelsApache 2.0 license for the database
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBigchainDBBlazegraphYugabyteDB
Erwähnungen in aktuellen Nachrichten

Infographic: What makes a Mobile Operator's setup future proof?
10. Februar 2024, Atos

bereitgestellt von Google News

Exploring the 10 BEST Python Libraries for Blockchain Applications
9. September 2023, DataDrivenInvestor

Using BigchainDB: A Database with Blockchain Characteristics
20. Januar 2022, Open Source For You

Blockchain Database Startup BigchainDB Raises €3 Million
27. September 2016, CoinDesk

ascribe announces scalable blockchain database BigchainDB - CoinReport
13. Februar 2016, CoinReport

7 blockchain firms join Bosch led GAIA-X consortium for vehicle identity
13. September 2022, Ledger Insights

bereitgestellt von Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Yugabyte Achieves PCI DSS Level 1 Compliance, Validating Secure and Scalable Distributed PostgreSQL for ...
14. März 2024, Business Wire

YugabyteDB Becomes First Distributed SQL Database Vendor to Complete CIS Benchmark
1. Februar 2024, Datanami

The surprising link between Formula One and enterprise PostgreSQL optimisation
28. März 2024, The Stack

YugabyteDB 2.21 Introduces Industry's First Native Disaster Recovery Orchestration Solution for a Distributed SQL ...
30. April 2024, Business Wire

Can Yugabyte Become The Defacto Database For Large-Scale, Cloud Native Applications?
19. Mai 2022, Forbes

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

SingleStore logo

Build AI apps with Vectors on SQL and JSON with milliseconds response times.
Try it today.

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Präsentieren Sie hier Ihr Produkt