DB-EnginesInfluxDB: Focus on building software with an easy-to-use serverless, scalable time series platformEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Apache Impala vs. Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS

Vergleich der Systemeigenschaften Apache Impala vs. Atos Standard Common Repository vs. Blazegraph vs. FatDB vs. InterSystems IRIS

Redaktionelle Informationen bereitgestellt von DB-Engines
NameApache Impala  Xaus Vergleich ausschliessenAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenFatDB  Xaus Vergleich ausschliessenInterSystems IRIS  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.Das Unternehmen FatDB/FatCloud hat im Februar 2014 seine Tätigkeit beendet. FatDB wurde eingestellt und erscheint deshalb nicht mehr im Ranking.
KurzbeschreibungAnalytic DBMS für HadoopHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Ein .NET NoSQL DBMS, das in SQL Server integriert werden kann.A containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalability
Primäres DatenbankmodellRelational DBMSDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document Store
Key-Value Store
Document Store
Key-Value Store
Object oriented DBMS
Relational DBMS
Sekundäre DatenbankmodelleDocument Store
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte13,77
Rang#40  Overall
#24  Relational DBMS
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte4,05
Rang#83  Overall
#14  Document Stores
#10  Key-Value Stores
#1  Object oriented DBMS
#45  Relational DBMS
Websiteimpala.apache.orgatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.intersystems.com/­products/­intersystems-iris
Technische Dokumentationimpala.apache.org/­impala-docs.htmlwiki.blazegraph.comdocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.cls
EntwicklerApache Software Foundation infoApache Top-Level Projekt, ursprünglich entwickelt von ClouderaAtos Convergence CreatorsBlazegraphFatCloudInterSystems
Erscheinungsjahr20132016200620122018
Aktuelle Version4.1.0, Juni 202217032.1.5, Maerz 20192023.3, Juni 2023
Lizenz infoCommercial or Open SourceOpen Source infoApache Version 2kommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarkommerziellkommerziell
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinneinnein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
ImplementierungsspracheC++JavaJavaC#
Server BetriebssystemeLinuxLinuxLinux
OS X
Windows
WindowsAIX
Linux
macOS
Ubuntu
Windows
DatenschemajaSchema and schema-less with LDAP viewsschemafreischemafreidepending on used data model
Typisierung infovordefinierte Datentypen, z.B. float oder datejaoptionalja infoRDF literal typesjaja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTneinjaja
Sekundärindizesjajajajaja
SQL infoSupport of SQLSQL-like DML and DDL statementsneinSPARQL is used as query languagenein infoÃœber Integration mit SQL Serverja
APIs und andere ZugriffskonzepteJDBC
ODBC
LDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
.NET Client API
LINQ
RESTful HTTP API
RPC
Windows WCF Bindings
JDBC
ODBC
RESTful HTTP API
Unterstützte ProgrammiersprachenAll languages supporting JDBC/ODBCAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C#.Net
C++
Java
JavaScript (Node.js)
Python
Server-seitige Scripts infoStored Proceduresja infoBenutzer definierte Funktionen und Integration von Map/Reduceneinjaja infoÃœber Applikationenja
Triggersneinjaneinja infoÃœber Applikationenja
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenShardingSharding infocell divisionShardingShardingSharding
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenfrei wählbarer Replikationsfaktorjajafrei wählbarer ReplikationsfaktorSource-Replica Replikation
MapReduce infoBietet ein API für Map/Reduce Operationenja infoAbfragen werden als Map/Reduce Jobs durchgeführtneinjanein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemEventual ConsistencyImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual Consistency
Immediate Consistency
Immediate Consistency
Fremdschlüssel inforeferenzielle Integritätneinneinja infoRelationships in Graphsneinja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenneinAtomic execution of specific operationsACIDneinACID
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajajaja
Durability infoDauerhafte Speicherung der Datenjajajajaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenneinjaja
Berechtigungskonzept infoZugriffskontrolleZugriffsrechte für Benutzer, Gruppen und Rollen infobasiert auf Apache Sentry und KerberosLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)nein infoSecurity Layer kann über Applikationen implementiert werdenyes
Weitere Informationen bereitgestellt vom Systemhersteller
Apache ImpalaAtos Standard Common RepositoryBlazegraphFatDBInterSystems IRIS
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Apache ImpalaAtos Standard Common RepositoryBlazegraphFatDBInterSystems IRIS
Erwähnungen in aktuellen Nachrichten

Apache Impala 4 Supports Operator Multi-Threading
29. Juli 2021, iProgrammer

Apache Impala becomes Top-Level Project
28. November 2017, SDTimes.com

StarRocks Brings Speedy OLAP Database to the Cloud
14. Juli 2022, Datanami

Apache Doris just 'graduated': Why care about this SQL data warehouse
24. Juni 2022, InfoWorld

Hudi: Uber Engineering’s Incremental Processing Framework on Apache Hadoop
12. März 2017, Uber

bereitgestellt von Google News

Infographic: What makes a Mobile Operator's setup future proof?
10. Februar 2024, Atos

bereitgestellt von Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Consultmed moving its e-referral software to InterSystems's IRIS for Health and more briefs
6. Mai 2024, Mobihealth News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26. März 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26. März 2024, Datanami

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11. Januar 2024, Yahoo Finance

InterSystems and IPA's Subsidiary BioStrand Collaborate to Unveil the Innovative Integration of Vector Search with ...
28. März 2024, Business Wire

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

SingleStore logo

Database for your real-time AI and Analytics Apps.
Try it today.

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Präsentieren Sie hier Ihr Produkt