DB-EnginesInfluxDB: Focus on building software with an easy-to-use serverless, scalable time series platformEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. Google Cloud Firestore vs. YugabyteDB

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. Google Cloud Firestore vs. YugabyteDB

Bitte wählen Sie ein weiteres System aus, um es in den Vergleich aufzunehmen.

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenGoogle Cloud Firestore  Xaus Vergleich ausschliessenYugabyteDB  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Cloud Firestore is an auto-scaling document database for storing, syncing, and querying data for mobile and web apps. It offers seamless integration with other Firebase and Google Cloud Platform products.High-performance distributed SQL database for global, internet-scale applications. Wire and feature compatible with PostgreSQL.
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document StoreRelational DBMS
Sekundäre DatenbankmodelleDocument Store
Wide Column Store
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte7,85
Rang#51  Overall
#8  Document Stores
Punkte2,91
Rang#102  Overall
#51  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comfirebase.google.com/­products/­firestorewww.yugabyte.com
Technische Dokumentationwiki.blazegraph.comfirebase.google.com/­docs/­firestoredocs.yugabyte.com
github.com/­yugabyte/­yugabyte-db
EntwicklerAtos Convergence CreatorsBlazegraphGoogleYugabyte Inc.
Erscheinungsjahr2016200620172017
Aktuelle Version17032.1.5, Maerz 20192.1, September 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarkommerziellOpen Source infoApache 2.0
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinjanein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
YugabyteDB Managed is the fully managed database-as-a-service offering of YugabyteDB. Get started quickly, and effortlessly ensure continuous availability and limitless scale of your cloud native applications.
ImplementierungsspracheJavaJavaC und C++
Server BetriebssystemeLinuxLinux
OS X
Windows
gehostetLinux
OS X
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreidepending on used data model
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesjaja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjaneinnein
Sekundärindizesjajajaja
SQL infoSupport of SQLneinSPARQL is used as query languageneinyes, PostgreSQL compatible
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
Android
gRPC (using protocol buffers) API
iOS
JavaScript API
RESTful HTTP API
JDBC
YCQL, an SQL-based flexible-schema API with its roots in Cassandra Query Language
YSQL - a fully relational SQL API that is wire compatible with the SQL language in PostgreSQL
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
Go
Java
JavaScript
JavaScript (Node.js)
Objective-C
Python
C
C#
C++
Go
Java
JavaScript (Node.js)
PHP
Python
Ruby
Rust
Scala
Server-seitige Scripts infoStored Proceduresneinjayes, Firebase Rules & Cloud Functionsja infosql, plpgsql, C
Triggersjaneinyes, with Cloud Functionsja
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardingHash and Range Sharding, row-level geo-partitioning
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren KnotenjajaMulti-Source ReplikationBased on Raft distributed consensus protocol, minimum 3 replicas for continuous availability
MapReduce infoBietet ein API für Map/Reduce OperationenneinUsing Cloud Dataflownein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationImmediate ConsistencyStrong consistency on writes and tunable consistency on reads
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDjaDistributed ACID with Serializable & Snapshot Isolation. Inspired by Google Spanner architecture.
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajaja
Durability infoDauerhafte Speicherung der Datenjajajaja infobased on RocksDB
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjanein
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)Access rights for users, groups and roles based on Google Cloud Identity and Access Management. Security Rules for 3rd party authentication using Firebase Auth.ja
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphGoogle Cloud FirestoreYugabyteDB
Specific characteristicsYugabyteDB is an open source distributed SQL database for cloud native transactional...
» mehr
Competitive advantagesPostgreSQL compatible: Get instantly productive with a PostgreSQL compatible RDBMS....
» mehr
Typical application scenariosSystems of record and engagement for cloud native applications that require resilience,...
» mehr
Market metrics2 Million+ lifetime clusters deployed, 6.5K+ GitHub stars, 7K YugabyteDB Community...
» mehr
Licensing and pricing modelsApache 2.0 license for the database
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphGoogle Cloud FirestoreYugabyteDB
DB-Engines Blog Posts

Cloud-based DBMS's popularity grows at high rates
12. Dezember 2019, Paul Andlinger

alle anzeigen

Erwähnungen in aktuellen Nachrichten

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Realtime vs Cloud Firestore: Which Firebase Database to go?
8. März 2024, Appinventiv

Google's AI-First Strategy Brings Vector Support To Cloud Databases
1. März 2024, Forbes

Google's Cloud Firestore is now generally available
31. Januar 2019, ZDNet

Google launches Cloud Firestore, a new document database for app developers
3. Oktober 2017, TechCrunch

Firestore and Python | NoSQL on Google Cloud
7. August 2020, Towards Data Science

bereitgestellt von Google News

Yugabyte Achieves PCI DSS Level 1 Compliance, Validating Secure and Scalable Distributed PostgreSQL for ...
14. März 2024, Business Wire

YugabyteDB Becomes First Distributed SQL Database Vendor to Complete CIS Benchmark
1. Februar 2024, Datanami

Yugabyte announced details and theme for Distributed SQL Summit Asia
18. April 2024, Martechcube

The surprising link between Formula One and enterprise PostgreSQL optimisation
28. März 2024, The Stack

Yugabyte adds multiregion Kubernetes support to YugabyteDB 2.18
24. Mai 2023, InfoWorld

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

SingleStore logo

Build AI apps with Vectors on SQL and JSON with milliseconds response times.
Try it today.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Präsentieren Sie hier Ihr Produkt