DB-EnginesInfluxDB: Focus on building software with an easy-to-use serverless, scalable time series platformEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. Ehcache vs. Google Cloud Firestore vs. InterSystems IRIS

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. Ehcache vs. Google Cloud Firestore vs. InterSystems IRIS

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenEhcache  Xaus Vergleich ausschliessenGoogle Cloud Firestore  Xaus Vergleich ausschliessenInterSystems IRIS  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.A widely adopted Java cache with tiered storage optionsCloud Firestore is an auto-scaling document database for storing, syncing, and querying data for mobile and web apps. It offers seamless integration with other Firebase and Google Cloud Platform products.A containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalability
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Key-Value StoreDocument StoreDocument Store
Key-Value Store
Object oriented DBMS
Relational DBMS
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte4,89
Rang#67  Overall
#8  Key-Value Stores
Punkte7,85
Rang#51  Overall
#8  Document Stores
Punkte4,05
Rang#83  Overall
#14  Document Stores
#10  Key-Value Stores
#1  Object oriented DBMS
#45  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.ehcache.orgfirebase.google.com/­products/­firestorewww.intersystems.com/­products/­intersystems-iris
Technische Dokumentationwiki.blazegraph.comwww.ehcache.org/­documentationfirebase.google.com/­docs/­firestoredocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.cls
EntwicklerAtos Convergence CreatorsBlazegraphTerracotta Inc, owned by Software AGGoogleInterSystems
Erscheinungsjahr20162006200920172018
Aktuelle Version17032.1.5, Maerz 20193.10.0, Maerz 20222023.3, Juni 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarOpen Source infoApache Version 2; commercial licenses availablekommerziellkommerziell
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinjanein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
ImplementierungsspracheJavaJavaJava
Server BetriebssystemeLinuxLinux
OS X
Windows
Alle Betriebssysteme mit einer Java VMgehostetAIX
Linux
macOS
Ubuntu
Windows
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreischemafreidepending on used data model
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesjajaja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjaneinneinja
Sekundärindizesjajaneinjaja
SQL infoSupport of SQLneinSPARQL is used as query languageneinneinja
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
JCacheAndroid
gRPC (using protocol buffers) API
iOS
JavaScript API
RESTful HTTP API
JDBC
ODBC
RESTful HTTP API
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
JavaGo
Java
JavaScript
JavaScript (Node.js)
Objective-C
Python
.Net
C++
Java
JavaScript (Node.js)
Python
Server-seitige Scripts infoStored Proceduresneinjaneinyes, Firebase Rules & Cloud Functionsja
Triggersjaneinja infoCache Event Listenersyes, with Cloud Functionsja
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingSharding infoby using Terracotta ServerShardingSharding
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjajaja infoby using Terracotta ServerMulti-Source ReplikationSource-Replica Replikation
MapReduce infoBietet ein API für Map/Reduce OperationenneinneinUsing Cloud Dataflownein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationTunable Consistency (Strong, Eventual, Weak)Immediate ConsistencyImmediate Consistency
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinneinja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDja infosupports JTA and can work as an XA resourcejaACID
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajajaja
Durability infoDauerhafte Speicherung der Datenjajaja infousing a tiered cache-storage approachjaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjajaja
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)neinAccess rights for users, groups and roles based on Google Cloud Identity and Access Management. Security Rules for 3rd party authentication using Firebase Auth.yes
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphEhcacheGoogle Cloud FirestoreInterSystems IRIS
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphEhcacheGoogle Cloud FirestoreInterSystems IRIS
DB-Engines Blog Posts

Cloud-based DBMS's popularity grows at high rates
12. Dezember 2019, Paul Andlinger

alle anzeigen

Erwähnungen in aktuellen Nachrichten

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Atlassian asks customers to patch critical Jira vulnerability
22. Juli 2021, BleepingComputer

Critical Jira Flaw in Atlassian Could Lead to RCE
22. Juli 2021, Threatpost

DZone Coding Java JBoss 5 to 7 in 11 steps
9. Januar 2014, dzone.com

bereitgestellt von Google News

Realtime vs Cloud Firestore: Which Firebase Database to go?
8. März 2024, Appinventiv

Google's AI-First Strategy Brings Vector Support To Cloud Databases
1. März 2024, Forbes

Google's Cloud Firestore is now generally available
31. Januar 2019, ZDNet

Google launches Cloud Firestore, a new document database for app developers
3. Oktober 2017, TechCrunch

Firestore and Python | NoSQL on Google Cloud
7. August 2020, Towards Data Science

bereitgestellt von Google News

Consultmed moving its e-referral software to InterSystems's IRIS for Health and more briefs
6. Mai 2024, Mobihealth News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26. März 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26. März 2024, Datanami

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11. Januar 2024, Yahoo Finance

Consultmed to re-platform eReferral software on InterSystems' IRIS for Health - Pulse+IT
30. April 2024, pulseit.news

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

SingleStore logo

Build AI apps with Vectors on SQL and JSON with milliseconds response times.
Try it today.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Präsentieren Sie hier Ihr Produkt