DB-EnginesInfluxDB: Focus on building software with an easy-to-use serverless, scalable time series platformEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. CouchDB vs. ScyllaDB vs. Weaviate

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. Blazegraph vs. CouchDB vs. ScyllaDB vs. Weaviate

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenCouchDB infosteht für "Cluster Of Unreliable Commodity Hardware"  Xaus Vergleich ausschliessenScyllaDB  Xaus Vergleich ausschliessenWeaviate  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Ein JSON - Document Store inspiriert durch Lotus Notes der von Server-Clustern bis Mobile Phones skaliertCassandra and DynamoDB compatible wide column storeAn AI-native realtime vector database engine that integrates scalable machine learning models.
Primäres DatenbankmodellDocument Store
Key-Value Store
Graph DBMS
RDF Store
Document StoreWide Column StoreVektor DBMS
Sekundäre DatenbankmodelleSpatial DBMS infousing the Geocouch extensionKey-Value Store
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte9,30
Rang#45  Overall
#7  Document Stores
Punkte4,75
Rang#68  Overall
#5  Wide Column Stores
Punkte1,73
Rang#143  Overall
#5  Vektor DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comcouchdb.apache.orgwww.scylladb.comgithub.com/­weaviate/­weaviate
weaviate.io
Technische Dokumentationwiki.blazegraph.comdocs.couchdb.org/­en/­stabledocs.scylladb.comweaviate.io/­developers/­weaviate
EntwicklerAtos Convergence CreatorsBlazegraphApache Software Foundation infoApache Top-Level Projekt, ursprünglich entwickelt von Damien Katz, ehemaliger Lotus Notes EntwicklerScyllaDBWeaviate B.V.
Erscheinungsjahr20162006200520152019
Aktuelle Version17032.1.5, Maerz 20193.3.3, Dezember 2023ScyllaDB Open Source 5.4.1, Jaenner 20241.19, Mai 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoerweiterte kommerzielle Lizenz verfügbarOpen Source infoApache Version 2Open Source infoOpen Source (AGPL), commercial license availableOpen Source infocommercial license available with Weaviate Enterprise
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinneinnein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
Scylla Cloud: Create real-time applications that run at global scale with Scylla Cloud, the industry’s most powerful NoSQL DBaaS
ImplementierungsspracheJavaJavaErlangC++Go
Server BetriebssystemeLinuxLinux
OS X
Windows
Android
BSD
Linux
OS X
Solaris
Windows
Linux
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreischemafreiyes, maps to GraphQL interface
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalja infoRDF literal typesneinjaja infostring, int, float, geo point, date, cross reference, fuzzy references
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjaneinneinnein
Sekundärindizesjajaja infoüber Viewsja infocluster global secondary indicesja infoall data objects are indexed in a semantic vector space (the Contextionary), all primitive fields are indexed
SQL infoSupport of SQLneinSPARQL is used as query languageneinSQL-like DML and DDL statements (CQL)GraphQL is used as query language
APIs und andere ZugriffskonzepteLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
RESTful HTTP/JSON APIProprietäres Protokoll infocompatible with CQL (Cassandra Query Language, an SQL-like language)
RESTful HTTP API (DynamoDB compatible)
Thrift
GraphQL query language
RESTful HTTP/JSON API
Unterstützte ProgrammiersprachenAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C
C#
ColdFusion
Erlang
Haskell
Java
JavaScript
Lisp
Lua
Objective-C
OCaml
Perl
PHP
PL/SQL
Python
Ruby
Smalltalk
For CQL interface: C#, C++, Clojure, Erlang, Go, Haskell, Java, JavaScript, Node.js, Perl, PHP, Python, Ruby, Rust, Scala
For DynamoDB interface: .Net, ColdFusion, Erlang, Groovy, Java, JavaScript, Perl, PHP, Python, Ruby
JavaScript / TypeScript
Python
Server-seitige Scripts infoStored ProceduresneinjaView Functions in JavaScriptyes, Luanein
Triggersjaneinjaneinnein
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingSharding infoimproved architecture with release 2.0ShardingSharding
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren KnotenjajaMulti-Source Replikation
Source-Replica Replikation
frei wählbarer Replikationsfaktor infoRepresentation of geographical distribution of servers is possibleja
MapReduce infoBietet ein API für Map/Reduce Operationenneinjaneinnein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual ConsistencyEventual Consistency
Tunable Consistency infocan be individually decided for each write operation
Eventual Consistency
Fremdschlüssel inforeferenzielle Integritätneinja infoRelationships in Graphsneinneinnein
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDnein infoatomare Operationen innerhalb eines Dokumentes möglichnein infoAtomicity and isolation are supported for single operationsnein
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajaja infoStrategie: optimistic lockingjaja
Durability infoDauerhafte Speicherung der Datenjajajajaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjaneinja infoin-memory tablesja
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)Zugriffsrechte für Benutzer pro Datenbank definierbarAccess rights for users can be defined per objectAPI Keys
OpenID Connect Discovery
Weitere Informationen bereitgestellt vom Systemhersteller
Atos Standard Common RepositoryBlazegraphCouchDB infosteht für "Cluster Of Unreliable Commodity Hardware"ScyllaDBWeaviate
Specific characteristicsScyllaDB is engineered to deliver predictable performance at scale. It’s adopted...
» mehr
Weaviate is an open source vector database that is robust, scalable, cloud-native,...
» mehr
Competitive advantagesHighly-performant (efficiently utilizes full resources of a node and network; millions...
» mehr
Flexible deployment - Free, open source or fully-managed cloud vector database service...
» mehr
Typical application scenariosScyllaDB is ideal for applications that require high throughput and low latency at...
» mehr
As a database supporting the development of generative AI and semantic search applications...
» mehr
Key customersDiscord, Epic Games, Expedia, Zillow, Comcast, Disney+ Hotstar, Samsung, ShareChat,...
» mehr
All companies that have data. ​
» mehr
Market metricsScyllaDB typically offers ~75% total cost of ownership savings, with ~5X higher throughput...
» mehr
As of mid 2023: Over 2 million open source downloads 3500+ Weaviate Slack community...
» mehr
Licensing and pricing modelsScyllaDB Open Source - free open source software (AGPL) ScyllaDB Enterprise - subscription-based...
» mehr
Weaviate is open-source, and free to use. Weaviate is also available as a fully managed...
» mehr

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBlazegraphCouchDB infosteht für "Cluster Of Unreliable Commodity Hardware"ScyllaDBWeaviate
DB-Engines Blog Posts

Couchbase climbs up the DB-Engines Ranking, increasing its popularity by 10% every month
2. Juni 2014, Matthias Gelbmann

alle anzeigen

Weaviate, an ANN Database with CRUD support
2. Februar 2021,  Etienne Dilocker, SeMI Technologies (sponsor) 

alle anzeigen

Erwähnungen in aktuellen Nachrichten

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

How to Automate A Blog Post App Deployment With GitHub Actions, Node.js, CouchDB, and Aptible
4. Dezember 2023, hackernoon.com

How to install the CouchDB NoSQL database on Debian Server 11
16. Juni 2022, TechRepublic

IBM Cloudant pulls plan to fund new foundational layer for CouchDB
15. März 2022, The Register

CouchDB 3.0 puts safety first
27. Februar 2020, InfoWorld

CouchDB 3.0 ends admin party era • DEVCLASS
27. Februar 2020, DevClass

bereitgestellt von Google News

ScyllaDB on AWS is a NoSQL Database Built for Gigabyte-to-Petabyte Scale | Amazon Web Services
6. Januar 2023, AWS Blog

Scylla Eyes Cassandra's NoSQL Workloads
13. Februar 2018, Datanami

ScyllaDB Database Review | eWeek
21. August 2018, eWeek

Scylla vs Cassandra: Performance Comparison - DataScienceCentral.com
9. Januar 2020, Data Science Central

Scylla review: Apache Cassandra supercharged
18. Dezember 2019, InfoWorld

bereitgestellt von Google News

Build enterprise-ready generative AI solutions with Cohere foundation models in Amazon Bedrock and Weaviate vector ...
24. Januar 2024, AWS Blog

Weaviate Partners with Snowflake to Bring Secure GenAI to Snowpark Container Services
8. Februar 2024, Datanami

Getting Started with Weaviate: A Beginner's Guide to Search with Vector Databases
18. Juli 2023, Towards Data Science

Weaviate Raises $50 Million Series B Funding to Meet Soaring Demand for AI Native Vector Database Technology ...
21. April 2023, PR Newswire

The 5 Best Vector Databases You Must Try in 2024
17. November 2023, KDnuggets

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

AllegroGraph logo

Graph Database Leader for AI Knowledge Graph Applications - The Most Secure Graph Database Available.
Free Download

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Präsentieren Sie hier Ihr Produkt