DB-EnginesInfluxDB: Focus on building software with an easy-to-use serverless, scalable time series platformEnglish
Deutsch
Informationen zu relationalen und NoSQL DatenbankmanagementsystemenEin Service von solid IT

DBMS > Atos Standard Common Repository vs. BigchainDB vs. Blazegraph vs. CockroachDB

Vergleich der Systemeigenschaften Atos Standard Common Repository vs. BigchainDB vs. Blazegraph vs. CockroachDB

Bitte wählen Sie ein weiteres System aus, um es in den Vergleich aufzunehmen.

Redaktionelle Informationen bereitgestellt von DB-Engines
NameAtos Standard Common Repository  Xaus Vergleich ausschliessenBigchainDB  Xaus Vergleich ausschliessenBlazegraph  Xaus Vergleich ausschliessenCockroachDB  Xaus Vergleich ausschliessen
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
KurzbeschreibungHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksBigchainDB is scalable blockchain database offering decentralization, immutability and native assetsHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.CockroachDB is a distributed database architected for modern cloud applications. It is wire compatible with PostgreSQL and backed by a Key-Value Store, which is either RocksDB or a purpose-built derivative, called Pebble.
Primäres DatenbankmodellDocument Store
Key-Value Store
Document StoreGraph DBMS
RDF Store
Relational DBMS
DB-Engines Ranking infomisst die Popularität von Datenbankmanagement- systemenranking trend
Trend Chart
Punkte0,79
Rang#212  Overall
#36  Document Stores
Punkte0,75
Rang#219  Overall
#19  Graph DBMS
#8  RDF Stores
Punkte6,15
Rang#55  Overall
#33  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositorywww.bigchaindb.comblazegraph.comwww.cockroachlabs.com
Technische Dokumentationbigchaindb.readthedocs.io/­en/­latestwiki.blazegraph.comwww.cockroachlabs.com/­docs
EntwicklerAtos Convergence CreatorsBlazegraphCockroach Labs
Erscheinungsjahr2016201620062015
Aktuelle Version17032.1.5, Maerz 201923.1.1, Mai 2023
Lizenz infoCommercial or Open SourcekommerziellOpen Source infoAGPL v3Open Source infoerweiterte kommerzielle Lizenz verfügbarOpen Source infoApache 2.0, commercial license available
Ausschließlich ein Cloud-Service infoNur als Cloud-Service verfügbarneinneinneinnein
DBaaS Angebote (gesponserte Links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
ImplementierungsspracheJavaPythonJavaGo
Server BetriebssystemeLinuxLinuxLinux
OS X
Windows
Linux
macOS
Windows
DatenschemaSchema and schema-less with LDAP viewsschemafreischemafreidynamic schema
Typisierung infovordefinierte Datentypen, z.B. float oder dateoptionalneinja infoRDF literal typesja
XML Unterstützung infoVerarbeitung von Daten in XML Format, beispielsweise Speicherung von XML-Strukturen und/oder Unterstützung von XPath, XQuery, XSLTjaneinnein
Sekundärindizesjajaja
SQL infoSupport of SQLneinneinSPARQL is used as query languageyes, wire compatible with PostgreSQL
APIs und andere ZugriffskonzepteLDAPCLI Client
RESTful HTTP API
Java API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
JDBC
Unterstützte ProgrammiersprachenAll languages with LDAP bindingsGo
Haskell
Java
JavaScript
Python
Ruby
.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C#
C++
Clojure
Go
Java
JavaScript (Node.js)
PHP
Python
Ruby
Rust
Server-seitige Scripts infoStored Proceduresneinjanein
Triggersjaneinnein
Partitionierungsmechanismen infoMethoden zum Speichern von unterschiedlichen Daten auf unterschiedlichen KnotenSharding infocell divisionShardingShardinghorizontal partitioning (by key range) infoall tables are translated to an ordered KV store and then broken down into 64MB ranges, which are then used as replicas in RAFT
Replikationsmechanismen infoMethoden zum redundanten Speichern von Daten auf mehreren Knotenjafrei wählbarer ReplikationsfaktorjaMulti-source replication using RAFT
MapReduce infoBietet ein API für Map/Reduce Operationenneinneinnein
Konsistenzkonzept infoMethoden zur Sicherstellung der Konsistenz in einem verteilten SystemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency
Fremdschlüssel inforeferenzielle Integritätneinneinja infoRelationships in Graphsja
Transaktionskonzept infoUnterstützung zur Sicherstellung der Datenintegrität bei nicht-atomaren DatenmanipulationenAtomic execution of specific operationsACIDACID
Concurrency infoUnterstützung von gleichzeitig ausgeführten Datenmanipulationenjajajaja
Durability infoDauerhafte Speicherung der Datenjayes,with MongoDB ord RethinkDBjaja
In-Memory Unterstützung infoGibt es Möglichkeiten einige oder alle Strukturen nur im Hauptspeicher zu haltenjanein
Berechtigungskonzept infoZugriffskontrolleLDAP bind authenticationyesSecurity and Authentication via Web Application Container (Tomcat, Jetty)Role-based access control

Weitere Informationen bereitgestellt vom Systemhersteller

Wir laden Vertreter der Systemhersteller ein uns zu kontaktieren, um die Systeminformationen zu aktualisieren und zu ergänzen,
sowie um Herstellerinformationen wie Schlüsselkunden, Vorteile gegenüber Konkurrenten und Marktmetriken anzuzeigen.

Zugehörige Produkte und Dienstleistungen

Wir laden Vertreter von Anbietern von zugehörigen Produkten ein uns zu kontaktieren, um hier Informationen über ihre Angebote zu präsentieren.

Weitere Ressourcen
Atos Standard Common RepositoryBigchainDBBlazegraphCockroachDB
Erwähnungen in aktuellen Nachrichten

Infographic: What makes a Mobile Operator's setup future proof?
10. Februar 2024, Atos

bereitgestellt von Google News

Exploring the 10 BEST Python Libraries for Blockchain Applications
9. September 2023, DataDrivenInvestor

Using BigchainDB: A Database with Blockchain Characteristics
20. Januar 2022, Open Source For You

Blockchain Database Startup BigchainDB Raises €3 Million
27. September 2016, CoinDesk

ascribe announces scalable blockchain database BigchainDB - CoinReport
13. Februar 2016, CoinReport

7 blockchain firms join Bosch led GAIA-X consortium for vehicle identity
13. September 2022, Ledger Insights

bereitgestellt von Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15. Dezember 2015, Datanami

Back to the future: Does graph database success hang on query language?
5. März 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19. August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24. September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26. September 2016, InfoWorld

bereitgestellt von Google News

Cockroach Labs Deepens Partnership with Google Cloud, CockroachDB Selected to Join Google Distributed Cloud
9. April 2024, PR Newswire

How DoorDash Migrated from Aurora Postgres to CockroachDB
5. Dezember 2023, The New Stack

DoorDash Uses CockroachDB to Create Config Management Platform for Microservices
14. Februar 2024, InfoQ.com

How to Unlock Real-Time Data Streams with CockroachDB and Amazon MSK | Amazon Web Services
6. November 2023, AWS Blog

CockroachDB tempts legacy databases to crawl into the cloud age
29. Januar 2024, The Register

bereitgestellt von Google News



Teilen sie diese Seite mit ihrem Netzwerk

Featured Products

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

SingleStore logo

The database to transact, analyze and contextualize your data in real time.
Try it today.

Präsentieren Sie hier Ihr Produkt