DB-EnginesInfluxDB: Focus on building software with an easy-to-use serverless, scalable time series platformEnglish
Deutsch
Knowledge Base of Relational and NoSQL Database Management Systemsprovided by solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. JanusGraph vs. TigerGraph vs. YugabyteDB

System Properties Comparison Atos Standard Common Repository vs. Blazegraph vs. JanusGraph vs. TigerGraph vs. YugabyteDB

Editorial information provided by DB-Engines
NameAtos Standard Common Repository  Xexclude from comparisonBlazegraph  Xexclude from comparisonJanusGraph infosuccessor of Titan  Xexclude from comparisonTigerGraph  Xexclude from comparisonYugabyteDB  Xexclude from comparison
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
DescriptionHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.A Graph DBMS optimized for distributed clusters infoIt was forked from the latest code base of Titan in January 2017A complete, distributed, parallel graph computing platform supporting web-scale data analytics in real-timeHigh-performance distributed SQL database for global, internet-scale applications. Wire and feature compatible with PostgreSQL.
Primary database modelDocument store
Key-value store
Graph DBMS
RDF store
Graph DBMSGraph DBMSRelational DBMS
Secondary database modelsDocument store
Wide column store
DB-Engines Ranking infomeasures the popularity of database management systemsranking trend
Trend Chart
Score0.75
Rank#219  Overall
#19  Graph DBMS
#8  RDF stores
Score1.94
Rank#129  Overall
#12  Graph DBMS
Score1.83
Rank#139  Overall
#13  Graph DBMS
Score2.91
Rank#102  Overall
#51  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comjanusgraph.orgwww.tigergraph.comwww.yugabyte.com
Technical documentationwiki.blazegraph.comdocs.janusgraph.orgdocs.tigergraph.comdocs.yugabyte.com
github.com/­yugabyte/­yugabyte-db
DeveloperAtos Convergence CreatorsBlazegraphLinux Foundation; originally developed as Titan by AureliusYugabyte Inc.
Initial release20162006201720172017
Current release17032.1.5, March 20190.6.3, February 20232.19, September 2023
License infoCommercial or Open SourcecommercialOpen Source infoextended commercial license availableOpen Source infoApache 2.0commercialOpen Source infoApache 2.0
Cloud-based only infoOnly available as a cloud servicenonononono
DBaaS offerings (sponsored links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
YugabyteDB Managed is the fully managed database-as-a-service offering of YugabyteDB. Get started quickly, and effortlessly ensure continuous availability and limitless scale of your cloud native applications.
Implementation languageJavaJavaJavaC++C and C++
Server operating systemsLinuxLinux
OS X
Windows
Linux
OS X
Unix
Windows
LinuxLinux
OS X
Data schemeSchema and schema-less with LDAP viewsschema-freeyesyesdepending on used data model
Typing infopredefined data types such as float or dateoptionalyes infoRDF literal typesyesyesyes
XML support infoSome form of processing data in XML format, e.g. support for XML data structures, and/or support for XPath, XQuery or XSLT.yesnonono
Secondary indexesyesyesyesyes
SQL infoSupport of SQLnoSPARQL is used as query languagenoSQL-like query language (GSQL)yes, PostgreSQL compatible
APIs and other access methodsLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
Java API
TinkerPop Blueprints
TinkerPop Frames
TinkerPop Gremlin
TinkerPop Rexster
GSQL (TigerGraph Query Language)
Kafka
RESTful HTTP/JSON API
JDBC
YCQL, an SQL-based flexible-schema API with its roots in Cassandra Query Language
YSQL - a fully relational SQL API that is wire compatible with the SQL language in PostgreSQL
Supported programming languagesAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
Clojure
Java
Python
C++
Java
C
C#
C++
Go
Java
JavaScript (Node.js)
PHP
Python
Ruby
Rust
Scala
Server-side scripts infoStored proceduresnoyesyesyesyes infosql, plpgsql, C
Triggersyesnoyesnoyes
Partitioning methods infoMethods for storing different data on different nodesSharding infocell divisionShardingyes infodepending on the used storage backend (e.g. Cassandra, HBase, BerkeleyDB)Hash and Range Sharding, row-level geo-partitioning
Replication methods infoMethods for redundantly storing data on multiple nodesyesyesyesBased on Raft distributed consensus protocol, minimum 3 replicas for continuous availability
MapReduce infoOffers an API for user-defined Map/Reduce methodsnoyes infovia Faunus, a graph analytics engineyesno
Consistency concepts infoMethods to ensure consistency in a distributed systemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationEventual Consistency
Immediate Consistency
Strong consistency on writes and tunable consistency on reads
Foreign keys infoReferential integritynoyes infoRelationships in Graphsyes infoRelationships in graphsyes infoRelationships in graphsyes
Transaction concepts infoSupport to ensure data integrity after non-atomic manipulations of dataAtomic execution of specific operationsACIDACIDACIDDistributed ACID with Serializable & Snapshot Isolation. Inspired by Google Spanner architecture.
Concurrency infoSupport for concurrent manipulation of datayesyesyesyesyes
Durability infoSupport for making data persistentyesyesyes infoSupports various storage backends: Cassandra, HBase, Berkeley DB, Akiban, Hazelcastyesyes infobased on RocksDB
In-memory capabilities infoIs there an option to define some or all structures to be held in-memory only.yesnono
User concepts infoAccess controlLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)User authentification and security via Rexster Graph ServerRole-based access controlyes
More information provided by the system vendor
Atos Standard Common RepositoryBlazegraphJanusGraph infosuccessor of TitanTigerGraphYugabyteDB
Specific characteristicsYugabyteDB is an open source distributed SQL database for cloud native transactional...
» more
Competitive advantagesPostgreSQL compatible: Get instantly productive with a PostgreSQL compatible RDBMS....
» more
Typical application scenariosSystems of record and engagement for cloud native applications that require resilience,...
» more
Market metrics2 Million+ lifetime clusters deployed, 6.5K+ GitHub stars, 7K YugabyteDB Community...
» more
Licensing and pricing modelsApache 2.0 license for the database
» more

We invite representatives of system vendors to contact us for updating and extending the system information,
and for displaying vendor-provided information such as key customers, competitive advantages and market metrics.

Related products and services

We invite representatives of vendors of related products to contact us for presenting information about their offerings here.

More resources
Atos Standard Common RepositoryBlazegraphJanusGraph infosuccessor of TitanTigerGraphYugabyteDB
Recent citations in the news

Infographic: What makes a Mobile Operator's setup future proof?
10 February 2024, Atos

provided by Google News

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19 August 2023, MarkTechPost

Back to the future: Does graph database success hang on query language?
5 March 2018, ZDNet

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15 December 2015, Datanami

Representation Learning on RDF* and LPG Knowledge Graphs
24 September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26 September 2016, InfoWorld

provided by Google News

Simple Deployment of a Graph Database: JanusGraph | by Edward Elson Kosasih
12 October 2020, Towards Data Science

Database Deep Dives: JanusGraph
8 August 2019, ibm.com

JanusGraph Picks Up Where TitanDB Left Off
13 January 2017, Datanami

Nordstrom Builds Flexible Backend Ops with Kubernetes, Spark and JanusGraph
3 October 2019, The New Stack

Compose for JanusGraph arrives on Bluemix
15 September 2017, ibm.com

provided by Google News

TigerGraph Unveils CoPilot, Version 4.0, and New CEO
30 April 2024, Datanami

How TigerGraph CoPilot enables graph-augmented AI
30 April 2024, InfoWorld

TigerGraph unveils GenAI assistant, introduces new CEO
30 April 2024, TechTarget

Aerospike takes on Neo4j and TigerGraph with launch of graph database
20 June 2023, SiliconANGLE News

TigerGraph Bolsters DB for Enterprise Graph Workloads
1 November 2023, Datanami

provided by Google News

Yugabyte Achieves PCI DSS Level 1 Compliance, Validating Secure and Scalable Distributed PostgreSQL for ...
14 March 2024, Business Wire

Yugabyte announced details and theme for Distributed SQL Summit Asia
18 April 2024, Martechcube

YugabyteDB 2.21 Introduces Industry's First Native Disaster Recovery Orchestration Solution for a Distributed SQL ...
30 April 2024, Yahoo Finance

YugabyteDB Becomes First Distributed SQL Database Vendor to Complete CIS Benchmark
1 February 2024, Datanami

The surprising link between Formula One and enterprise PostgreSQL optimisation
28 March 2024, The Stack

provided by Google News



Share this page

Featured Products

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

SingleStore logo

Build AI apps with Vectors on SQL and JSON with milliseconds response times.
Try it today.

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Present your product here