DB-EnginesExtremeDB: mitigate connectivity issues in a DBMSEnglish
Deutsch
Knowledge Base of Relational and NoSQL Database Management Systemsprovided by solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. GeoMesa vs. HyperSQL vs. InterSystems IRIS

System Properties Comparison Atos Standard Common Repository vs. Blazegraph vs. GeoMesa vs. HyperSQL vs. InterSystems IRIS

Editorial information provided by DB-Engines
NameAtos Standard Common Repository  Xexclude from comparisonBlazegraph  Xexclude from comparisonGeoMesa  Xexclude from comparisonHyperSQL infoalso known as HSQLDB  Xexclude from comparisonInterSystems IRIS  Xexclude from comparison
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
DescriptionHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.GeoMesa is a distributed spatio-temporal DBMS based on various systems as storage layer.Multithreaded, transactional RDBMS written in Java infoalso known as HSQLDBA containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalability
Primary database modelDocument store
Key-value store
Graph DBMS
RDF store
Spatial DBMSRelational DBMSDocument store
Key-value store
Object oriented DBMS
Relational DBMS
DB-Engines Ranking infomeasures the popularity of database management systemsranking trend
Trend Chart
Score0.75
Rank#219  Overall
#19  Graph DBMS
#8  RDF stores
Score0.78
Rank#213  Overall
#4  Spatial DBMS
Score3.49
Rank#87  Overall
#47  Relational DBMS
Score4.05
Rank#83  Overall
#14  Document stores
#10  Key-value stores
#1  Object oriented DBMS
#45  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.geomesa.orghsqldb.orgwww.intersystems.com/­products/­intersystems-iris
Technical documentationwiki.blazegraph.comwww.geomesa.org/­documentation/­stable/­user/­index.htmlhsqldb.org/­web/­hsqlDocsFrame.htmldocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.cls
DeveloperAtos Convergence CreatorsBlazegraphCCRi and othersInterSystems
Initial release20162006201420012018
Current release17032.1.5, March 20194.0.5, February 20242.7.2, June 20232023.3, June 2023
License infoCommercial or Open SourcecommercialOpen Source infoextended commercial license availableOpen Source infoApache License 2.0Open Source infobased on BSD licensecommercial
Cloud-based only infoOnly available as a cloud servicenonononono
DBaaS offerings (sponsored links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
Implementation languageJavaJavaScalaJava
Server operating systemsLinuxLinux
OS X
Windows
All OS with a Java VM infoEmbedded (into Java applications) and Client-Server operating modesAIX
Linux
macOS
Ubuntu
Windows
Data schemeSchema and schema-less with LDAP viewsschema-freeyesyesdepending on used data model
Typing infopredefined data types such as float or dateoptionalyes infoRDF literal typesyesyesyes
XML support infoSome form of processing data in XML format, e.g. support for XML data structures, and/or support for XPath, XQuery or XSLT.yesnonoyes
Secondary indexesyesyesyesyesyes
SQL infoSupport of SQLnoSPARQL is used as query languagenoyesyes
APIs and other access methodsLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
HTTP API infoJDBC via HTTP
JDBC
ODBC
JDBC
ODBC
RESTful HTTP API
Supported programming languagesAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
All languages supporting JDBC/ODBC
Java
.Net
C++
Java
JavaScript (Node.js)
Python
Server-side scripts infoStored proceduresnoyesnoJava, SQLyes
Triggersyesnonoyesyes
Partitioning methods infoMethods for storing different data on different nodesSharding infocell divisionShardingdepending on storage layernoneSharding
Replication methods infoMethods for redundantly storing data on multiple nodesyesyesdepending on storage layernoneSource-replica replication
MapReduce infoOffers an API for user-defined Map/Reduce methodsnoyesnono
Consistency concepts infoMethods to ensure consistency in a distributed systemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationdepending on storage layerImmediate ConsistencyImmediate Consistency
Foreign keys infoReferential integritynoyes infoRelationships in Graphsnoyesyes
Transaction concepts infoSupport to ensure data integrity after non-atomic manipulations of dataAtomic execution of specific operationsACIDnoACIDACID
Concurrency infoSupport for concurrent manipulation of datayesyesyesyesyes
Durability infoSupport for making data persistentyesyesyesyesyes
In-memory capabilities infoIs there an option to define some or all structures to be held in-memory only.yesdepending on storage layeryesyes
User concepts infoAccess controlLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)yes infodepending on the DBMS used for storagefine grained access rights according to SQL-standardyes
More information provided by the system vendor
Atos Standard Common RepositoryBlazegraphGeoMesaHyperSQL infoalso known as HSQLDBInterSystems IRIS
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» more

We invite representatives of system vendors to contact us for updating and extending the system information,
and for displaying vendor-provided information such as key customers, competitive advantages and market metrics.

Related products and services

We invite representatives of vendors of related products to contact us for presenting information about their offerings here.

More resources
Atos Standard Common RepositoryBlazegraphGeoMesaHyperSQL infoalso known as HSQLDBInterSystems IRIS
DB-Engines blog posts

Spatial database management systems
6 April 2021, Matthias Gelbmann

show all

Recent citations in the news

Infographic: What makes a Mobile Operator's setup future proof?
10 February 2024, Atos

provided by Google News

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19 August 2023, MarkTechPost

Back to the future: Does graph database success hang on query language?
5 March 2018, ZDNet

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15 December 2015, Datanami

Representation Learning on RDF* and LPG Knowledge Graphs
24 September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26 September 2016, InfoWorld

provided by Google News

HyperSQL DataBase flaw leaves library vulnerable to RCE
24 October 2022, The Daily Swig

Introduction to JDBC with HSQLDB tutorial
14 November 2022, TheServerSide.com

provided by Google News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26 March 2024, HIT Consultant

Consultmed to re-platform eReferral software on InterSystems' IRIS for Health - Pulse+IT
30 April 2024, Pulse+IT News

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26 March 2024, Datanami

InterSystems signs deal with Consultmed for ‘replatforming’
1 May 2024, The Medical Republic

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11 January 2024, Yahoo Finance

provided by Google News



Share this page

Featured Products

SingleStore logo

Database for your real-time AI and Analytics Apps.
Try it today.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Present your product here