DB-EnginesExtremeDB: mitigate connectivity issues in a DBMSEnglish
Deutsch
Knowledge Base of Relational and NoSQL Database Management Systemsprovided by solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. ClickHouse vs. Ingres vs. InterSystems IRIS

System Properties Comparison Atos Standard Common Repository vs. Blazegraph vs. ClickHouse vs. Ingres vs. InterSystems IRIS

Editorial information provided by DB-Engines
NameAtos Standard Common Repository  Xexclude from comparisonBlazegraph  Xexclude from comparisonClickHouse  Xexclude from comparisonIngres  Xexclude from comparisonInterSystems IRIS  Xexclude from comparison
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
DescriptionHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.A high-performance, column-oriented SQL DBMS for online analytical processing (OLAP) that uses all available system resources to their full potential to process each analytical query as fast as possible. It is available as both an open-source software and a cloud offering.Well established RDBMSA containerised multi-model DBMS, interoperability and analytics data platform with wide capabilities for vertical and horizontal scalability
Primary database modelDocument store
Key-value store
Graph DBMS
RDF store
Relational DBMSRelational DBMSDocument store
Key-value store
Object oriented DBMS
Relational DBMS
Secondary database modelsTime Series DBMS
DB-Engines Ranking infomeasures the popularity of database management systemsranking trend
Trend Chart
Score0.75
Rank#219  Overall
#19  Graph DBMS
#8  RDF stores
Score16.34
Rank#38  Overall
#23  Relational DBMS
Score4.11
Rank#81  Overall
#44  Relational DBMS
Score4.05
Rank#83  Overall
#14  Document stores
#10  Key-value stores
#1  Object oriented DBMS
#45  Relational DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comclickhouse.comwww.actian.com/­databases/­ingreswww.intersystems.com/­products/­intersystems-iris
Technical documentationwiki.blazegraph.comclickhouse.com/­docsdocs.actian.com/­ingresdocs.intersystems.com/­irislatest/­csp/­docbook/­DocBook.UI.Page.cls
DeveloperAtos Convergence CreatorsBlazegraphClickhouse Inc.Actian CorporationInterSystems
Initial release2016200620161974 infooriginally developed at University Berkely in early 1970s2018
Current release17032.1.5, March 2019v24.4.1.2088-stable, May 202411.2, May 20222023.3, June 2023
License infoCommercial or Open SourcecommercialOpen Source infoextended commercial license availableOpen Source infoApache 2.0commercialcommercial
Cloud-based only infoOnly available as a cloud servicenonononono
DBaaS offerings (sponsored links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
  • Aiven for Clickhouse: Managed cloud data warehousing with high-speed analytics.
  • DoubleCloud: Fully managed ClickHouse alongside best-in-class managed open-source services to build analytics at scale.
  • ClickHouse Cloud: Get the performance you love from open source ClickHouse in a serverless offering that takes care of the details so you can spend more time getting insight out of the fastest database on earth.
Implementation languageJavaJavaC++C
Server operating systemsLinuxLinux
OS X
Windows
FreeBSD
Linux
macOS
AIX
HP Open VMS
HP-UX
Linux
Solaris
Windows
AIX
Linux
macOS
Ubuntu
Windows
Data schemeSchema and schema-less with LDAP viewsschema-freeyesyesdepending on used data model
Typing infopredefined data types such as float or dateoptionalyes infoRDF literal typesyesyesyes
XML support infoSome form of processing data in XML format, e.g. support for XML data structures, and/or support for XPath, XQuery or XSLT.yesnono infobut tools for importing/exporting data from/to XML-files availableyes
Secondary indexesyesyesyesyesyes
SQL infoSupport of SQLnoSPARQL is used as query languageClose to ANSI SQL (SQL/JSON + extensions)yesyes
APIs and other access methodsLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
gRPC
HTTP REST
JDBC
MySQL wire protocol
ODBC
PostgreSQL wire protocol
Proprietary protocol
.NET Client API
JDBC
ODBC
proprietary protocol (OpenAPI)
JDBC
ODBC
RESTful HTTP API
Supported programming languagesAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
C# info3rd party library
C++
Elixir info3rd party library
Go info3rd party library
Java info3rd party library
JavaScript (Node.js) info3rd party library
Kotlin info3rd party library
Nim info3rd party library
Perl info3rd party library
PHP info3rd party library
Python info3rd party library
R info3rd party library
Ruby info3rd party library
Rust
Scala info3rd party library
.Net
C++
Java
JavaScript (Node.js)
Python
Server-side scripts infoStored proceduresnoyesyesyesyes
Triggersyesnonoyesyes
Partitioning methods infoMethods for storing different data on different nodesSharding infocell divisionShardingkey based and customhorizontal partitioning infoIngres Star to access multiple databases simultaneouslySharding
Replication methods infoMethods for redundantly storing data on multiple nodesyesyesAsynchronous and synchronous physical replication; geographically distributed replicas; support for object storages.Ingres ReplicatorSource-replica replication
MapReduce infoOffers an API for user-defined Map/Reduce methodsnononono
Consistency concepts infoMethods to ensure consistency in a distributed systemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationImmediate ConsistencyImmediate ConsistencyImmediate Consistency
Foreign keys infoReferential integritynoyes infoRelationships in Graphsnoyesyes
Transaction concepts infoSupport to ensure data integrity after non-atomic manipulations of dataAtomic execution of specific operationsACIDnoACIDACID
Concurrency infoSupport for concurrent manipulation of datayesyesyesyes infoMVCCyes
Durability infoSupport for making data persistentyesyesyesyesyes
In-memory capabilities infoIs there an option to define some or all structures to be held in-memory only.yesyesnoyes
User concepts infoAccess controlLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)Access rights for users and roles. Column and row based policies. Quotas and resource limits. Pluggable authentication with LDAP and Kerberos. Password based, X.509 certificate, and SSH key authentication.fine grained access rights according to SQL-standardyes
More information provided by the system vendor
Atos Standard Common RepositoryBlazegraphClickHouseIngresInterSystems IRIS
Specific characteristicsInterSystems IRIS is a complete cloud-first data platform which includes a multi-model...
» more

We invite representatives of system vendors to contact us for updating and extending the system information,
and for displaying vendor-provided information such as key customers, competitive advantages and market metrics.

Related products and services
3rd partiesDoubleCloud: Fully managed ClickHouse alongside best-in-class managed open-source services to build analytics at scale.
» more

Aiven for Clickhouse: Managed cloud data warehousing with high-speed analytics.
» more

We invite representatives of vendors of related products to contact us for presenting information about their offerings here.

More resources
Atos Standard Common RepositoryBlazegraphClickHouseIngresInterSystems IRIS
Recent citations in the news

Infographic: What makes a Mobile Operator's setup future proof?
10 February 2024, Atos

provided by Google News

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15 December 2015, Datanami

Back to the future: Does graph database success hang on query language?
5 March 2018, ZDNet

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19 August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24 September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26 September 2016, InfoWorld

provided by Google News

Why Clickhouse Should Be Your Next Database
6 July 2023, The New Stack

ClickHouse Cloud & Amazon S3 Express One Zone: Making a blazing fast analytical database even faster | Amazon ...
28 November 2023, AWS Blog

A 1000x Faster Database Solution: ClickHouse’s Aaron Katz
1 November 2023, GrowthCap

From Open Source to SaaS: the Journey of ClickHouse
16 January 2024, InfoQ.com

ClickHouse Announces Launch of ClickPipes
26 September 2023, Datanami

provided by Google News

Postgres pioneer Michael Stonebraker promises to upend the database once more
26 December 2023, The Register

New startup from Postgres creator puts the database at heart of software stack
12 March 2024, TechCrunch

Actian Launches Ingres as a Fully-Managed Cloud Service
24 September 2021, Integration Developers

PostgreSQL now top developer choice ahead of MySQL, according to massive new survey • DEVCLASS
13 June 2023, DevClass

Dr. Michael Stonebraker: A Short History of Database Systems
1 February 2019, The New Stack

provided by Google News

Consultmed moving its e-referral software to InterSystems's IRIS for Health and more briefs
6 May 2024, Mobihealth News

Unlocking the Power of Generative AI: InterSystems IRIS with Vector Search -
26 March 2024, HIT Consultant

InterSystems Expands IRIS Data Platform with Vector Search to Support Next-Gen AI Applications
26 March 2024, Datanami

InterSystems Introduces Two New Cloud-Native Smart Data Services to Accelerate Database and Machine Learning ...
11 January 2024, Yahoo Finance

InterSystems and IPA's Subsidiary BioStrand Collaborate to Unveil the Innovative Integration of Vector Search with ...
28 March 2024, Business Wire

provided by Google News



Share this page

Featured Products

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

AllegroGraph logo

Graph Database Leader for AI Knowledge Graph Applications - The Most Secure Graph Database Available.
Free Download

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Present your product here