DB-EnginesInfluxDB: Focus on building software with an easy-to-use serverless, scalable time series platformEnglish
Deutsch
Knowledge Base of Relational and NoSQL Database Management Systemsprovided by solid IT

DBMS > Atos Standard Common Repository vs. Blazegraph vs. eXtremeDB vs. Microsoft Azure Synapse Analytics vs. SiteWhere

System Properties Comparison Atos Standard Common Repository vs. Blazegraph vs. eXtremeDB vs. Microsoft Azure Synapse Analytics vs. SiteWhere

Editorial information provided by DB-Engines
NameAtos Standard Common Repository  Xexclude from comparisonBlazegraph  Xexclude from comparisoneXtremeDB  Xexclude from comparisonMicrosoft Azure Synapse Analytics infopreviously named Azure SQL Data Warehouse  Xexclude from comparisonSiteWhere  Xexclude from comparison
This system has been discontinued and will be removed from the DB-Engines ranking.Amazon has acquired Blazegraph's domain and (probably) product. It is said that Amazon Neptune is based on Blazegraph.
DescriptionHighly scalable database system, designed for managing session and subscriber data in modern mobile communication networksHigh-performance graph database supporting Semantic Web (RDF/SPARQL) and Graph Database (tinkerpop3, blueprints, vertex-centric) APIs with scale-out and High Availability.Natively in-memory DBMS with options for persistency, high-availability and clusteringElastic, large scale data warehouse service leveraging the broad eco-system of SQL ServerM2M integration platform for persisting/querying time series data
Primary database modelDocument store
Key-value store
Graph DBMS
RDF store
Relational DBMS
Time Series DBMS
Relational DBMSTime Series DBMS
DB-Engines Ranking infomeasures the popularity of database management systemsranking trend
Trend Chart
Score0.75
Rank#219  Overall
#19  Graph DBMS
#8  RDF stores
Score0.74
Rank#223  Overall
#103  Relational DBMS
#18  Time Series DBMS
Score20.56
Rank#31  Overall
#19  Relational DBMS
Score0.06
Rank#356  Overall
#35  Time Series DBMS
Websiteatos.net/en/convergence-creators/portfolio/standard-common-repositoryblazegraph.comwww.mcobject.comazure.microsoft.com/­services/­synapse-analyticsgithub.com/­sitewhere/­sitewhere
Technical documentationwiki.blazegraph.comwww.mcobject.com/­docs/­extremedb.htmdocs.microsoft.com/­azure/­synapse-analyticssitewhere1.sitewhere.io/­index.html
DeveloperAtos Convergence CreatorsBlazegraphMcObjectMicrosoftSiteWhere
Initial release20162006200120162010
Current release17032.1.5, March 20198.2, 2021
License infoCommercial or Open SourcecommercialOpen Source infoextended commercial license availablecommercialcommercialOpen Source infoCommon Public Attribution License Version 1.0
Cloud-based only infoOnly available as a cloud servicenononoyesno
DBaaS offerings (sponsored links) infoDatabase as a Service

Providers of DBaaS offerings, please contact us to be listed.
Implementation languageJavaJavaC and C++C++Java
Server operating systemsLinuxLinux
OS X
Windows
AIX
HP-UX
Linux
macOS
Solaris
Windows
hostedLinux
OS X
Windows
Data schemeSchema and schema-less with LDAP viewsschema-freeyesyespredefined scheme
Typing infopredefined data types such as float or dateoptionalyes infoRDF literal typesyesyesyes
XML support infoSome form of processing data in XML format, e.g. support for XML data structures, and/or support for XPath, XQuery or XSLT.yesno infosupport of XML interfaces availablenono
Secondary indexesyesyesyesyesno
SQL infoSupport of SQLnoSPARQL is used as query languageyes infowith the option: eXtremeSQLyesno
APIs and other access methodsLDAPJava API
RESTful HTTP API
SPARQL QUERY
SPARQL UPDATE
TinkerPop 3
.NET Client API
JDBC
JNI
ODBC
Proprietary protocol
RESTful HTTP API
ADO.NET
JDBC
ODBC
HTTP REST
Supported programming languagesAll languages with LDAP bindings.Net
C
C++
Java
JavaScript
PHP
Python
Ruby
.Net
C
C#
C++
Java
Lua
Python
Scala
C#
Java
PHP
Server-side scripts infoStored proceduresnoyesyesTransact SQL
Triggersyesnoyes infoby defining eventsno
Partitioning methods infoMethods for storing different data on different nodesSharding infocell divisionShardinghorizontal partitioning / shardingSharding, horizontal partitioningSharding infobased on HBase
Replication methods infoMethods for redundantly storing data on multiple nodesyesyesActive Replication Fabric™ for IoT
Multi-source replication infoby means of eXtremeDB Cluster option
Source-replica replication infoby means of eXtremeDB High Availability option
yesselectable replication factor infobased on HBase
MapReduce infoOffers an API for user-defined Map/Reduce methodsnononono
Consistency concepts infoMethods to ensure consistency in a distributed systemImmediate Consistency or Eventual Consistency depending on configurationImmediate Consistency or Eventual Consistency depending on configurationImmediate ConsistencyImmediate ConsistencyImmediate Consistency
Foreign keys infoReferential integritynoyes infoRelationships in Graphsyesno infodocs.microsoft.com/­en-us/­azure/­synapse-analytics/­sql-data-warehouse/­sql-data-warehouse-table-constraintsno
Transaction concepts infoSupport to ensure data integrity after non-atomic manipulations of dataAtomic execution of specific operationsACIDACIDACIDno
Concurrency infoSupport for concurrent manipulation of datayesyesyes infoOptimistic (MVCC) and pessimistic (locking) strategies availableyesyes
Durability infoSupport for making data persistentyesyesyesyesyes
In-memory capabilities infoIs there an option to define some or all structures to be held in-memory only.yesyesno
User concepts infoAccess controlLDAP bind authenticationSecurity and Authentication via Web Application Container (Tomcat, Jetty)yesUsers with fine-grained authorization concept
More information provided by the system vendor
Atos Standard Common RepositoryBlazegrapheXtremeDBMicrosoft Azure Synapse Analytics infopreviously named Azure SQL Data WarehouseSiteWhere
Specific characteristicseXtremeDB is an in-memory and/or persistent database system that offers an ultra-small...
» more
Competitive advantageseXtremeDB databases can be modeled relationally or as objects and can utilize SQL...
» more
Typical application scenariosIoT application across all markets: Industrial Control, Netcom, Telecom, Defense,...
» more
Key customersSchneider Electronics, F5 Networks, TNS, Boeing, Northrop Grumman, GoPro, ViaSat,...
» more
Market metricsWith hundreds of customers and over 30 million devices/applications using the product...
» more
Licensing and pricing modelsFor server use cases, there is a simple per-server license irrespective of the number...
» more

We invite representatives of system vendors to contact us for updating and extending the system information,
and for displaying vendor-provided information such as key customers, competitive advantages and market metrics.

Related products and services

We invite representatives of vendors of related products to contact us for presenting information about their offerings here.

More resources
Atos Standard Common RepositoryBlazegrapheXtremeDBMicrosoft Azure Synapse Analytics infopreviously named Azure SQL Data WarehouseSiteWhere
Recent citations in the news

Infographic: What makes a Mobile Operator's setup future proof?
10 February 2024, Atos

provided by Google News

Back to the future: Does graph database success hang on query language?
5 March 2018, ZDNet

Harnessing GPUs Delivers a Big Speedup for Graph Analytics
15 December 2015, Datanami

This AI Paper Introduces A Comprehensive RDF Dataset With Over 26 Billion Triples Covering Scholarly Data Across All Scientific Disciplines
19 August 2023, MarkTechPost

Representation Learning on RDF* and LPG Knowledge Graphs
24 September 2020, Towards Data Science

Faster with GPUs: 5 turbocharged databases
26 September 2016, InfoWorld

provided by Google News

McObject Announces the Release of eXtremeDB/rt 1.2
23 May 2023, Embedded Computing Design

McObject Announces Availability of eXtremeDB/rt for Green Hills Software's INTEGRITY RTOS
21 April 2022, GlobeNewswire

Latest embedded DBMS supports asymmetric multiprocessing systems
24 May 2023, Embedded

With eXtremeDB Database, Spreadbrokers Targets Real-Time Trading
27 March 2012, GlobeNewswire

McObject’s new eXtremeDB Cluster provides distributed database solution for real-time apps
20 July 2011, Embedded

provided by Google News

General Available: Azure Synapse Runtime for Apache Spark 3.4 is now GA | Azure updates
8 April 2024, azure.microsoft.com

Migrate Microsoft Azure Synapse Analytics to Amazon Redshift using AWS SCT | Amazon Web Services
18 October 2023, AWS Blog

Azure Synapse vs. Databricks: Data Platform Comparison 2024
26 March 2024, eWeek

Azure Synapse Runtime for Apache Spark 3.2 End of Support | Azure updates
22 March 2024, azure.microsoft.com

Azure Synapse Analytics: Everything you need to know about Microsoft's cloud analytics platform
24 September 2023, DataScientest

provided by Google News

11 Best Open source IoT Platforms To Develop Smart Projects
9 March 2023, H2S Media

provided by Google News



Share this page

Featured Products

Milvus logo

Vector database designed for GenAI, fully equipped for enterprise implementation.
Try Managed Milvus for Free

Datastax Astra logo

Bring all your data to Generative AI applications with vector search enabled by the most scalable
vector database available.
Try for Free

SingleStore logo

Database for your real-time AI and Analytics Apps.
Try it today.

RaimaDB logo

RaimaDB, embedded database for mission-critical applications. When performance, footprint and reliability matters.
Try RaimaDB for free.

Neo4j logo

See for yourself how a graph database can make your life easier.
Use Neo4j online for free.

Present your product here